Enzyme search using ESM-1b and colabfold database This colab enables you to find potential proteins that will act similarly as your input enzymes. You will need to provide a fasta file with any numerical value representing your enzymes (i.e. Km, Kcat/Km, toxicity, ...), then the colab will give you a list of proteins similar to the given enzymes, sorted by the numerical value predicted by the regressor.
What you need to prepare
- A fasta file containing the sequence and numerical value representing the sequence (see the example fasta format below)
Example fasta format:
>Example_sequence_1 8.104
PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASK
>Example_sequence_2 2.04
MIAQIHILEGRSDKETLIRRVSEAISRSLDAPLTSVRVIIMEMAKGHFGIGGELASK
>Example_sequence_3 5.20
SIATIHILEGRSDEDKETLIRRVISRSLDAPLTSVRVIIMTMAKKHFGIGGELASK