-
Notifications
You must be signed in to change notification settings - Fork 229
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
feat: ligand: support obable readable files
- Loading branch information
1 parent
7180fe7
commit 330e455
Showing
5 changed files
with
124 additions
and
29 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,19 @@ | ||
{ | ||
"entities": [ | ||
{ | ||
"type": "protein", | ||
"sequence": "MDALYKSTVAKFNEVIQLDCSTEFFSIALSSIAGILLLLLLFRSKRHSSLKLPPGKLGIPFIGESFIFLRALRSNSLEQFFDERVKKFGLVFKTSLIGHPTVVLCGPAGNRLILSNEEKLVQMSWPAQFMKLMGENSVATRRGEDHIVMRSALAGFFGPGALQSYIGKMNTEIQSHINEKWKGKDEVNVLPLVRELVFNISAILFFNIYDKQEQDRLHKLLETILVGSFALPIDLPGFGFHRALQGRAKLNKIMLSLIKKRKEDLQSGSATATQDLLSVLLTFRDDKGTPLTNDEILDNFSSLLHASYDTTTSPMALIFKLLSSNPECYQKVVQEQLEILSNKEEGEEITWKDLKAMKYTWQVAQETLRMFPPVFGTFRKAITDIQYDGYTIPKGWKLLWTTYSTHPKDLYFNEPEKFMPSRFDQEGKHVAPYTFLPFGGGQRSCVGWEFSKMEILLFVHHFVKTFSSYTPVDPDEKISGDPLPPLPSKGFSIKLFPRP", | ||
"count": 1 | ||
}, | ||
{ | ||
"type": "ligand", | ||
"ccd": "HEM", | ||
"count": 1 | ||
}, | ||
{ | ||
"type": "ligand", | ||
"smiles": "CC1=C2CC[C@@]3(CCCC(=C)[C@H]3C[C@@H](C2(C)C)CC1)C", | ||
"count": 1 | ||
} | ||
] | ||
} |
19 changes: 19 additions & 0 deletions
19
apps/protein_folding/helixfold3/data/demo_p450_heme_sdf.json
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,19 @@ | ||
{ | ||
"entities": [ | ||
{ | ||
"type": "protein", | ||
"sequence": "MDALYKSTVAKFNEVIQLDCSTEFFSIALSSIAGILLLLLLFRSKRHSSLKLPPGKLGIPFIGESFIFLRALRSNSLEQFFDERVKKFGLVFKTSLIGHPTVVLCGPAGNRLILSNEEKLVQMSWPAQFMKLMGENSVATRRGEDHIVMRSALAGFFGPGALQSYIGKMNTEIQSHINEKWKGKDEVNVLPLVRELVFNISAILFFNIYDKQEQDRLHKLLETILVGSFALPIDLPGFGFHRALQGRAKLNKIMLSLIKKRKEDLQSGSATATQDLLSVLLTFRDDKGTPLTNDEILDNFSSLLHASYDTTTSPMALIFKLLSSNPECYQKVVQEQLEILSNKEEGEEITWKDLKAMKYTWQVAQETLRMFPPVFGTFRKAITDIQYDGYTIPKGWKLLWTTYSTHPKDLYFNEPEKFMPSRFDQEGKHVAPYTFLPFGGGQRSCVGWEFSKMEILLFVHHFVKTFSSYTPVDPDEKISGDPLPPLPSKGFSIKLFPRP", | ||
"count": 1 | ||
}, | ||
{ | ||
"type": "ligand", | ||
"ccd": "HEM", | ||
"count": 1 | ||
}, | ||
{ | ||
"type": "ligand", | ||
"sdf": "/mnt/data/yinying/tests/helixfold/ligands/60119277-3d.sdf", | ||
"count": 1 | ||
} | ||
] | ||
} |
19 changes: 19 additions & 0 deletions
19
apps/protein_folding/helixfold3/data/demo_p450_heme_smiles.json
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,19 @@ | ||
{ | ||
"entities": [ | ||
{ | ||
"type": "protein", | ||
"sequence": "MDALYKSTVAKFNEVIQLDCSTEFFSIALSSIAGILLLLLLFRSKRHSSLKLPPGKLGIPFIGESFIFLRALRSNSLEQFFDERVKKFGLVFKTSLIGHPTVVLCGPAGNRLILSNEEKLVQMSWPAQFMKLMGENSVATRRGEDHIVMRSALAGFFGPGALQSYIGKMNTEIQSHINEKWKGKDEVNVLPLVRELVFNISAILFFNIYDKQEQDRLHKLLETILVGSFALPIDLPGFGFHRALQGRAKLNKIMLSLIKKRKEDLQSGSATATQDLLSVLLTFRDDKGTPLTNDEILDNFSSLLHASYDTTTSPMALIFKLLSSNPECYQKVVQEQLEILSNKEEGEEITWKDLKAMKYTWQVAQETLRMFPPVFGTFRKAITDIQYDGYTIPKGWKLLWTTYSTHPKDLYFNEPEKFMPSRFDQEGKHVAPYTFLPFGGGQRSCVGWEFSKMEILLFVHHFVKTFSSYTPVDPDEKISGDPLPPLPSKGFSIKLFPRP", | ||
"count": 1 | ||
}, | ||
{ | ||
"type": "ligand", | ||
"smiles": "CC1=C(C2=CC3=C(C(=C([N-]3)C=C4C(=C(C(=N4)C=C5C(=C(C(=N5)C=C1[N-]2)C)C=C)C)C=C)C)CCC(=O)O)CCC(=O)O.[Fe+2]", | ||
"count": 1 | ||
}, | ||
{ | ||
"type": "ligand", | ||
"smiles": "CC1=C2CC[C@@]3(CCCC(=C)[C@H]3C[C@@H](C2(C)C)CC1)C", | ||
"count": 1 | ||
} | ||
] | ||
} |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters