-
Notifications
You must be signed in to change notification settings - Fork 229
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
- Loading branch information
1 parent
3bba852
commit 7653585
Showing
5 changed files
with
91 additions
and
1 deletion.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
25 changes: 25 additions & 0 deletions
25
apps/protein_folding/helixfold3/data/demo_p450_heme_coval.json
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,25 @@ | ||
{ | ||
"entities": [ | ||
{ | ||
"type": "protein", | ||
"sequence": "MDALYKSTVAKFNEVIQLDCSTEFFSIALSSIAGILLLLLLFRSKRHSSLKLPPGKLGIPFIGESFIFLRALRSNSLEQFFDERVKKFGLVFKTSLIGHPTVVLCGPAGNRLILSNEEKLVQMSWPAQFMKLMGENSVATRRGEDHIVMRSALAGFFGPGALQSYIGKMNTEIQSHINEKWKGKDEVNVLPLVRELVFNISAILFFNIYDKQEQDRLHKLLETILVGSFALPIDLPGFGFHRALQGRAKLNKIMLSLIKKRKEDLQSGSATATQDLLSVLLTFRDDKGTPLTNDEILDNFSSLLHASYDTTTSPMALIFKLLSSNPECYQKVVQEQLEILSNKEEGEEITWKDLKAMKYTWQVAQETLRMFPPVFGTFRKAITDIQYDGYTIPKGWKLLWTTYSTHPKDLYFNEPEKFMPSRFDQEGKHVAPYTFLPFGGGQRSCVGWEFSKMEILLFVHHFVKTFSSYTPVDPDEKISGDPLPPLPSKGFSIKLFPRP", | ||
"count": 1 | ||
}, | ||
{ | ||
"type": "ligand", | ||
"ccd": "HEM", | ||
"count": 1 | ||
}, | ||
{ | ||
"type": "ligand", | ||
"smiles": "CC1=C2CC[C@@]3(CCCC(=C)[C@H]3C[C@@H](C2(C)C)CC1)C", | ||
"count": 1 | ||
}, | ||
{ | ||
"type": "bond", | ||
"bond": "A,CYS,445,SG,B,HEM,1,FE,covale,2.3", | ||
"_comment": "<chain-id>,<residue name>,<residue index>,<atom id>,<chain-id>,<residue name>,<residue index>,<atom id>,<bond type>,<bond length>", | ||
"_also_comment": "For ccd input, use CCD key as residue name; for smiles and file input, use `UNK-<index>` where index is the chain order you input" | ||
} | ||
] | ||
} |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters